Lineage for d1a1d__ (1a1d -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14279Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
  6. 14280Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 14281Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (1 PDB entry)
  8. 14282Domain d1a1d__: 1a1d - [25394]

Details for d1a1d__

PDB Entry: 1a1d (more details)

PDB Description: yeast rna polymerase subunit rpb8, nmr, minimized average structure, alpha carbons only

SCOP Domain Sequences for d1a1d__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1d__ b.40.4.8 (-) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)}
msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
llmrlegnyrnlnnlkqenayllirr

SCOP Domain Coordinates for d1a1d__:

Click to download the PDB-style file with coordinates for d1a1d__.
(The format of our PDB-style files is described here.)

Timeline for d1a1d__: