Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries) |
Domain d4n0aa_: 4n0a A: [253835] automated match to d3bw1a_ protein/RNA complex |
PDB Entry: 4n0a (more details), 3.15 Å
SCOPe Domain Sequences for d4n0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0aa_ b.38.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese rrcemvfirgdtvtlistps
Timeline for d4n0aa_: