Lineage for d1gkh__ (1gkh -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) 
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (3 proteins) Protein Gene V protein [50316] (2 species) Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries) 
Domain d1gkh__: 1gkh - [25371]
Details for d1gkh__
PDB Entry: 1gkh (more details), 1.7 Å
PDB Description: mutant k69h of gene v protein (single-stranded dna binding protein)
SCOP Domain Sequences for d1gkh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkh__ b.40.4.7 (-) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
ytvhlssfhvgqfgslmidrlrlvpa
SCOP Domain Coordinates for d1gkh__:
Click to download the PDB-style file with coordinates for d1gkh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gkh__:
- d1gkh__ first appeared (with stable ids) in SCOP 1.55
- d1gkh__ appears in SCOP 1.57
- d1gkh__ appears in SCOP 1.61
- d1gkh__ appears in the current release, SCOPe 2.08, called d1gkha_
View in 3D