Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries) |
Domain d4lueb3: 4lue B:250-530 [253699] Other proteins in same PDB: d4luea1, d4luea2, d4luea4, d4lueb1, d4lueb2, d4lueb4 automated match to d1fmka3 complexed with ca, cl, gol, imd, vse |
PDB Entry: 4lue (more details), 3.04 Å
SCOPe Domain Sequences for d4lueb3:
Sequence, based on SEQRES records: (download)
>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe elynimmrcwknrpeerptfeyiqsvlddfytatesqyeei
>d4lueb3 d.144.1.7 (B:250-530) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkplaeanvmktl qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi eqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainftiksdvwsfgillm eivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpeerptfeyiq svlddfytatesqyeei
Timeline for d4lueb3:
View in 3D Domains from other chains: (mouse over for more information) d4luea1, d4luea2, d4luea3, d4luea4 |