Lineage for d1a0ia1 (1a0i A:241-349)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1315383Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 1315384Protein ATP-dependent DNA ligase [50310] (2 species)
  7. 1315385Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry)
  8. 1315386Domain d1a0ia1: 1a0i A:241-349 [25363]
    Other proteins in same PDB: d1a0ia2
    protein/DNA complex; complexed with atp

Details for d1a0ia1

PDB Entry: 1a0i (more details), 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1a0ia1:

Sequence, based on SEQRES records: (download)

>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr

Sequence, based on observed residues (ATOM records): (download)

>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr

SCOPe Domain Coordinates for d1a0ia1:

Click to download the PDB-style file with coordinates for d1a0ia1.
(The format of our PDB-style files is described here.)

Timeline for d1a0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0ia2