Lineage for d1a0i_1 (1a0i 241-349)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (3 proteins) Protein ATP-dependent DNA ligase [50310] (2 species) 
Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry) 
Domain d1a0i_1: 1a0i 241-349 [25363]
Other proteins in same PDB: d1a0i_2
Details for d1a0i_1
PDB Entry: 1a0i (more details), 2.6 Å
PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp
SCOP Domain Sequences for d1a0i_1:
Sequence, based on SEQRES records: (download)
>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr
Sequence, based on observed residues (ATOM records): (download)
>d1a0i_1 b.40.4.6 (241-349) ATP-dependent DNA ligase {Bacteriophage T7}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr
SCOP Domain Coordinates for d1a0i_1:
Click to download the PDB-style file with coordinates for d1a0i_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0i_1:
- d1a0i_1 first appeared (with stable ids) in SCOP 1.55
- d1a0i_1 appears in SCOP 1.59
- d1a0i_1 appears in the current release, SCOPe 2.08, called d1a0ia1
View in 3D
