Lineage for d4lmfd1 (4lmf D:2-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387375Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2387376Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2387377Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2387381Protein Complement C1S component [89258] (1 species)
  7. 2387382Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)
  8. 2387393Domain d4lmfd1: 4lmf D:2-116 [253627]
    Other proteins in same PDB: d4lmfa2, d4lmfb2, d4lmfc2, d4lmfd2
    automated match to d1nt0a1
    complexed with ca, na

Details for d4lmfd1

PDB Entry: 4lmf (more details), 2.92 Å

PDB Description: c1s cub1-egf-cub2
PDB Compounds: (D:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lmfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmfd1 b.23.1.1 (D:2-116) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
ptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgd
teegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatd

SCOPe Domain Coordinates for d4lmfd1:

Click to download the PDB-style file with coordinates for d4lmfd1.
(The format of our PDB-style files is described here.)

Timeline for d4lmfd1: