Lineage for d4ktya4 (4kty A:628-725)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373287Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2373398Family b.1.5.0: automated matches [254331] (1 protein)
    not a true family
  6. 2373399Protein automated matches [254755] (1 species)
    not a true protein
  7. 2373400Species Human (Homo sapiens) [TaxId:9606] [256348] (1 PDB entry)
  8. 2373402Domain d4ktya4: 4kty A:628-725 [253440]
    Other proteins in same PDB: d4ktya1, d4ktya2, d4ktyb1, d4ktyb2
    automated match to d1ex0a3
    complexed with ca, gol, so4

Details for d4ktya4

PDB Entry: 4kty (more details), 1.98 Å

PDB Description: Fibrin-stabilizing factor with a bound ligand
PDB Compounds: (A:) coagulation factor xiii a chain

SCOPe Domain Sequences for d4ktya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktya4 b.1.5.0 (A:628-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtviveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqi

SCOPe Domain Coordinates for d4ktya4:

Click to download the PDB-style file with coordinates for d4ktya4.
(The format of our PDB-style files is described here.)

Timeline for d4ktya4: