SCOP 1.75: Domain d1bkba2: 1bkb A:75-139

Lineage for d1bkba2 (1bkb A:75-139)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [50298] (1 PDB entry)

8. Domain d1bkba2: 1bkb A:75-139 [25341]
   Other proteins in same PDB: d1bkba1
   CASP3
   mutant

Details for d1bkba2

PDB Entry: 1bkb, 1.75 Å

PDB Description: initiation factor 5a from archebacterium pyrobaculum aerophilum

PDB Compounds: (A:) translation initiation factor 5a

SCOP Domain Sequences for d1bkba2:

Sequence; same for both SEQRES and ATOM records:

>d1bkba2 b.40.4.5 (A:75-139) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
iiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaevevwqildryki
irvkg

Timeline for d1bkba2:

• d1bkba2 first appeared (with stable ids) in SCOP 1.55, called d1bkb_2
  
• d1bkba2 appears in SCOP 1.73
  
• d1bkba2 appears in SCOPe 2.01
  
• d1bkba2 appears in the current release, SCOPe 2.08