Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [50297] (2 PDB entries) |
Domain d1eifa2: 1eif A:74-133 [25340] Other proteins in same PDB: d1eifa1 |
PDB Entry: 1eif (more details), 1.9 Å
SCOP Domain Sequences for d1eifa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eifa2 b.40.4.5 (A:74-133) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Methanococcus jannaschii [TaxId: 2190]} idrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrvig
Timeline for d1eifa2: