| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
| Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species) |
| Species Streptomyces antibioticus [TaxId:1890] [50289] (1 PDB entry) |
| Domain d1e3pa2: 1e3p A:656-717 [25328] Other proteins in same PDB: d1e3pa1, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7 partly disordered complexed with so4, wo4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1e3p (more details), 2.5 Å
SCOPe Domain Sequences for d1e3pa2:
Sequence, based on SEQRES records: (download)
>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]}
gsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgqkvqveiaeidsr
gk
>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]}
gsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk
Timeline for d1e3pa2: