Lineage for d1e3pa2 (1e3p A:656-717)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790111Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species)
  7. 2790114Species Streptomyces antibioticus [TaxId:1890] [50289] (1 PDB entry)
  8. 2790115Domain d1e3pa2: 1e3p A:656-717 [25328]
    Other proteins in same PDB: d1e3pa1, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
    partly disordered
    complexed with so4, wo4

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1e3pa2

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) Polyribonucleotide nucleotidyltransferase

SCOPe Domain Sequences for d1e3pa2:

Sequence, based on SEQRES records: (download)

>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]}
gsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgqkvqveiaeidsr
gk

Sequence, based on observed residues (ATOM records): (download)

>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]}
gsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk

SCOPe Domain Coordinates for d1e3pa2:

Click to download the PDB-style file with coordinates for d1e3pa2.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa2: