Lineage for d4keaa_ (4kea A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509481Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries)
  8. 2509486Domain d4keaa_: 4kea A: [253250]
    automated match to d1r1da_
    complexed with mpd; mutant

Details for d4keaa_

PDB Entry: 4kea (more details), 1.7 Å

PDB Description: crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121
PDB Compounds: (A:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d4keaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4keaa_ c.69.1.0 (A:) automated matches {Bacillus sp. [TaxId: 129908]}
seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
avdipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakl
drivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiers
leffakha

SCOPe Domain Coordinates for d4keaa_:

Click to download the PDB-style file with coordinates for d4keaa_.
(The format of our PDB-style files is described here.)

Timeline for d4keaa_: