Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.387: STING C-terminal-like [254119] (1 superfamily) 5 helices and 5 strands in one mixed beta-sheet, one long bent helix |
Superfamily d.387.1: STING, TM173 CTD-like [254144] (1 family) Pfam PF15009, PubMed 22579474 |
Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins) |
Protein automated matches [254746] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256318] (6 PDB entries) |
Domain d4kbya_: 4kby A: [253229] automated match to d4ef5a_ complexed with c2e |
PDB Entry: 4kby (more details), 2.36 Å
SCOPe Domain Sequences for d4kbya_:
Sequence, based on SEQRES records: (download)
>d4kbya_ d.387.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nvahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpdnls vvdpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlfamsq dakagfsredrleqaklfcrtleeiledvpesrnncrlivyqeptdgnsfslsqevlrhi rqee
>d4kbya_ d.387.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nvahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpdnls vvdpnirfrdmlpqnrvysnsvyeilengqpagvcileyatplqtlfamsqdakagfsre drleqaklfcrtleeiledvpesrnncrlivyqeptdgnsfslsqevlrhirqee
Timeline for d4kbya_: