SCOPe 2.07: Domain d4jd2d1: 4jd2 D:1-120

Lineage for d4jd2d1 (4jd2 D:1-120)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)

6. Protein automated matches [254752] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256327] (1 PDB entry)

8. Domain d4jd2d1: 4jd2 D:1-120 [252893]
   Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_
   automated match to d1k8kd1
   complexed with atp, ca, pg4

Details for d4jd2d1

PDB Entry: 4jd2, 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF

PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d4jd2d1:

Sequence; same for both SEQRES and ATOM records:

>d4jd2d1 d.198.2.1 (D:1-120) automated matches {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

Timeline for d4jd2d1:

• d4jd2d1 first appeared in SCOPe 2.04
  
• d4jd2d1 appears in SCOPe 2.06
  
• d4jd2d1 appears in the current release, SCOPe 2.08