Lineage for d4iymp_ (4iym P:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2517240Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 2517260Domain d4iymp_: 4iym P: [252763]
    Other proteins in same PDB: d4iymc2, d4iyme2, d4iymo2
    automated match to d3k2wb_
    complexed with mg, nad

Details for d4iymp_

PDB Entry: 4iym (more details), 2.2 Å

PDB Description: Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD, target 011934
PDB Compounds: (P:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4iymp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iymp_ c.82.1.0 (P:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
rwpsgikdg

SCOPe Domain Coordinates for d4iymp_:

Click to download the PDB-style file with coordinates for d4iymp_.
(The format of our PDB-style files is described here.)

Timeline for d4iymp_: