Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein) barrel, closed; n=5, S=10 automatically mapped to Pfam PF01330 |
Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species) tetramer; binds Holliday junction |
Species Escherichia coli [TaxId:562] [50261] (5 PDB entries) |
Domain d1bdxc3: 1bdx C:1-64 [25272] Other proteins in same PDB: d1bdxa1, d1bdxa2, d1bdxb1, d1bdxb2, d1bdxc1, d1bdxc2, d1bdxd1, d1bdxd2 protein/DNA complex |
PDB Entry: 1bdx (more details), 6 Å
SCOPe Domain Sequences for d1bdxc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdxc3 b.40.4.2 (C:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]} migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll ygfn
Timeline for d1bdxc3: