SCOPe 2.04: Domain d1cuka3: 1cuk A:1-64

Lineage for d1cuka3 (1cuk A:1-64)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
   barrel, closed; n=5, S=10
   automatically mapped to Pfam PF01330

6. Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)

8. Domain d1cuka3: 1cuk A:1-64 [25265]
   Other proteins in same PDB: d1cuka1, d1cuka2

Details for d1cuka3

PDB Entry: 1cuk, 1.9 Å

PDB Description: escherichia coli ruva protein at ph 4.9 and room temperature

PDB Compounds: (A:) ruva protein

SCOPe Domain Sequences for d1cuka3:

Sequence; same for both SEQRES and ATOM records:

>d1cuka3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

Timeline for d1cuka3:

• d1cuka3 first appeared (with stable ids) in SCOP 1.55, called d1cuk_3
  
• d1cuka3 appears in SCOPe 2.03
  
• d1cuka3 appears in SCOPe 2.05
  
• d1cuka3 appears in the current release, SCOPe 2.08