Lineage for d4hpna1 (4hpn A:1-123)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554790Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)
  8. 2554802Domain d4hpna1: 4hpn A:1-123 [252481]
    Other proteins in same PDB: d4hpna2
    automated match to d3sjna1
    complexed with ca, imd, ni

Details for d4hpna1

PDB Entry: 4hpn (more details), 1.6 Å

PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4hpna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpna1 d.54.1.0 (A:1-123) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mkitavrthllehrldtpfesasmrfdrrahvlveiecddgtvgwgeclgparpnaavvq
aysgwligqdprqtekiwavlynalrdqgqrglsltalsgidialwdikgkhygasisml
lgg

SCOPe Domain Coordinates for d4hpna1:

Click to download the PDB-style file with coordinates for d4hpna1.
(The format of our PDB-style files is described here.)

Timeline for d4hpna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hpna2