SCOPe 2.04: Domain d4hnaa1: 4hna A:1-245

Lineage for d4hnaa1 (4hna A:1-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (9 PDB entries)

8. Domain d4hnaa1: 4hna A:1-245 [252469]
   Other proteins in same PDB: d4hnaa2, d4hnab2, d4hnad_, d4hnak_
   automated match to d4ihja1
   complexed with adp, alf, gdp, gtp, mg

Details for d4hnaa1

PDB Entry: 4hna, 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4hnaa1:

Sequence, based on SEQRES records:

>d4hnaa1 c.32.1.1 (A:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Sequence, based on observed residues (ATOM records):

>d4hnaa1 c.32.1.1 (A:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravf
vdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirklad
qctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyns
iltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslrfd

Timeline for d4hnaa1:

• d4hnaa1 is new in SCOPe 2.04-stable
  
• d4hnaa1 appears in SCOPe 2.05
  
• d4hnaa1 appears in the current release, SCOPe 2.08