SCOPe 2.07: Domain d4hful1: 4hfu L:1-106

Lineage for d4hful1 (4hfu L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4hful1: 4hfu L:1-106 [252438]
   Other proteins in same PDB: d4hfua1, d4hfua2, d4hfub_, d4hful2
   automated match to d1dn0a1
   complexed with nag

Details for d4hful1

PDB Entry: 4hfu, 3.11 Å

PDB Description: crystal structure of fab 8m2 in complex with a h2n2 influenza virus hemagglutinin

PDB Compounds: (L:) Fab 8M2 light chain

SCOPe Domain Sequences for d4hful1:

Sequence; same for both SEQRES and ATOM records:

>d4hful1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspaslsvspgeratlscrasqsvagnlawyqqkpgqaprlliygastratgipa
rfsgsgsgteftltitslqsedfavyycqqynnwppwtfgqgtkvdi

Timeline for d4hful1:

• d4hful1 first appeared in SCOPe 2.04
  
• d4hful1 appears in SCOPe 2.06
  
• d4hful1 appears in the current release, SCOPe 2.08