Lineage for d4h81a2 (4h81 A:186-373)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580489Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2580490Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69805] (1 species)
  7. 2580491Species Norway rat (Rattus norvegicus) [TaxId:10116] [69806] (15 PDB entries)
  8. 2580493Domain d4h81a2: 4h81 A:186-373 [252387]
    Other proteins in same PDB: d4h81a1
    automated match to d3tz0a2
    complexed with adp, k, mg, wj2

Details for d4h81a2

PDB Entry: 4h81 (more details), 2.05 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/(r)-2-chloro-3-phenylpropanoic acid complex with adp
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4h81a2:

Sequence, based on SEQRES records: (download)

>d4h81a2 d.122.1.4 (A:186-373) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhi

Sequence, based on observed residues (ATOM records): (download)

>d4h81a2 d.122.1.4 (A:186-373) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhi

SCOPe Domain Coordinates for d4h81a2:

Click to download the PDB-style file with coordinates for d4h81a2.
(The format of our PDB-style files is described here.)

Timeline for d4h81a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h81a1