Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries) |
Domain d4h13f_: 4h13 F: [252359] Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13d2, d4h13g_, d4h13h_ automated match to d1vf5s_ complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq |
PDB Entry: 4h13 (more details), 3.07 Å
SCOPe Domain Sequences for d4h13f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h13f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} teemlyaallsfglifvgwglgvlllkiqga
Timeline for d4h13f_: