Class b: All beta proteins [48724] (126 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) |
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries) |
Domain d1fnwh1: 1fnw H:2101-2207 [25231] Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2 complexed with cd |
PDB Entry: 1fnw (more details), 3.9 Å
SCOP Domain Sequences for d1fnwh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnwh1 b.40.2.2 (H:2101-2207) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes} qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe
Timeline for d1fnwh1: