Lineage for d4gcvc_ (4gcv C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308377Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (2 PDB entries)
  8. 2308381Domain d4gcvc_: 4gcv C: [252193]
    automated match to d2f2eb_
    complexed with gol, na, po4

Details for d4gcvc_

PDB Entry: 4gcv (more details), 2.3 Å

PDB Description: Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
PDB Compounds: (C:) Putative transcription protein

SCOPe Domain Sequences for d4gcvc_:

Sequence, based on SEQRES records: (download)

>d4gcvc_ a.4.5.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
dgrtvpleqctvqagpaaseemrqrl

Sequence, based on observed residues (ATOM records): (download)

>d4gcvc_ a.4.5.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
pleqctvqagpaaseemrqrl

SCOPe Domain Coordinates for d4gcvc_:

Click to download the PDB-style file with coordinates for d4gcvc_.
(The format of our PDB-style files is described here.)

Timeline for d4gcvc_: