Lineage for d4gboa_ (4gbo A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376378Species Thermobifida fusca [TaxId:2021] [256269] (2 PDB entries)
  8. 2376379Domain d4gboa_: 4gbo A: [252189]
    automated match to d2bena_
    complexed with cu, gol, iod, na

Details for d4gboa_

PDB Entry: 4gbo (more details), 2 Å

PDB Description: structure of t.fusca e7
PDB Compounds: (A:) e7

SCOPe Domain Sequences for d4gboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gboa_ b.1.18.0 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
sdvnfv

SCOPe Domain Coordinates for d4gboa_:

Click to download the PDB-style file with coordinates for d4gboa_.
(The format of our PDB-style files is described here.)

Timeline for d4gboa_: