Lineage for d1bxta1 (1bxt A:1-119)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. Protein Streptococcal superantigen SSA [50238] (1 species)
  7. Species Streptococcus pyogenes [TaxId:1314] [50239] (1 PDB entry)
  8. 1540995Domain d1bxta1: 1bxt A:1-119 [25210]
    Other proteins in same PDB: d1bxta2, d1bxtb2

Details for d1bxta1

PDB Entry: 1bxt (more details), 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes
PDB Compounds: (A:) protein (streptococcal superantigen)

SCOPe Domain Sequences for d1bxta1:

Sequence, based on SEQRES records: (download)

>d1bxta1 b.40.2.2 (A:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncyysegnscknakktcmyggvtehhrn

Sequence, based on observed residues (ATOM records): (download)

>d1bxta1 b.40.2.2 (A:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncktcmyggvtehhrn

SCOPe Domain Coordinates for d1bxta1:

Click to download the PDB-style file with coordinates for d1bxta1.
(The format of our PDB-style files is described here.)

Timeline for d1bxta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxta2