Lineage for d1eu3a1 (1eu3 A:2A-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789093Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 2789094Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 2789095Domain d1eu3a1: 1eu3 A:2A-96 [25206]
    Other proteins in same PDB: d1eu3a2, d1eu3b2, d1eu3b3
    complexed with k, po4, zn

Details for d1eu3a1

PDB Entry: 1eu3 (more details), 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes
PDB Compounds: (A:) superantigen smez-2

SCOPe Domain Sequences for d1eu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu3a1 b.40.2.2 (A:2A-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyqk

SCOPe Domain Coordinates for d1eu3a1:

Click to download the PDB-style file with coordinates for d1eu3a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu3a1: