Lineage for d1d6ec1 (1d6e C:2-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2788968Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2788969Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2788979Domain d1d6ec1: 1d6e C:2-121 [25188]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb1, d1d6eb2, d1d6ec2

Details for d1d6ec1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb
PDB Compounds: (C:) enterotoxin type b

SCOPe Domain Sequences for d1d6ec1:

Sequence, based on SEQRES records: (download)

>d1d6ec1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1d6ec1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkrktcmyggvteh

SCOPe Domain Coordinates for d1d6ec1:

Click to download the PDB-style file with coordinates for d1d6ec1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ec1: