Lineage for d1se4a1 (1se4 A:1-121)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-keySuperfamily b.40.2: Bacterial enterotoxins [50203] (3 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries) 
Domain d1se4a1: 1se4 A:1-121 [25187]
Other proteins in same PDB: d1se4a2
Details for d1se4a1
PDB Entry: 1se4 (more details), 1.9 Å
PDB Description: staphylococcal enterotoxin b complexed with lactose
PDB Compounds: (A:) staphylococcal enterotoxin bSCOPe Domain Sequences for d1se4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se4a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h
SCOPe Domain Coordinates for d1se4a1:
Click to download the PDB-style file with coordinates for d1se4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1se4a1:
- d1se4a1 first appeared (with stable ids) in SCOP 1.55, called d1se4_1
- d1se4a1 appears in SCOPe 2.07
View in 3D
