Lineage for d4eoda_ (4eod A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687468Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 1687506Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) (S)
    Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349
  5. 1687507Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins)
  6. 1687508Protein Ferredoxin-dependent bilin reductase [254408] (2 species)
  7. 1687509Species Synechocystis sp. [TaxId:1111708] [256248] (3 PDB entries)
  8. 1687511Domain d4eoda_: 4eod A: [251790]
    automated match to d2d1ea_
    complexed with bla, cl

Details for d4eoda_

PDB Entry: 4eod (more details), 1.3 Å

PDB Description: Crystal structure of H74E synechocystis sp. pcya sp. PCYA
PDB Compounds: (A:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d4eoda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eoda_ d.248.2.1 (A:) Ferredoxin-dependent bilin reductase {Synechocystis sp. [TaxId: 1111708]}
dlsltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrc
yqtpqfrkmelelakvgkgldilhcvmfpeplyglplfgcdivagpggvsaaiadlsptq
sdrqlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdfl
qihchqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlf
dvi

SCOPe Domain Coordinates for d4eoda_:

Click to download the PDB-style file with coordinates for d4eoda_.
(The format of our PDB-style files is described here.)

Timeline for d4eoda_: