SCOPe 2.04: Domain d4eoca_: 4eoc A:

Lineage for d4eoca_ (4eoc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
   alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567

4. Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family)
   Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349

5. Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins)

6. Protein Ferredoxin-dependent bilin reductase [254408] (2 species)

7. Species Synechocystis sp. [TaxId:1111708] [256248] (3 PDB entries)

8. Domain d4eoca_: 4eoc A: [251789]
   automated match to d2d1ea_
   complexed with bla, cl

Details for d4eoca_

PDB Entry: 4eoc, 1.49 Å

PDB Description: Crystal structure of h74q Synechocystis sp. PCYA

PDB Compounds: (A:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d4eoca_:

Sequence; same for both SEQRES and ATOM records:

>d4eoca_ d.248.2.1 (A:) Ferredoxin-dependent bilin reductase {Synechocystis sp. [TaxId: 1111708]}
ltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcyqt
pqfrkmqlelakvgkgldilhcvmfpeplyglplfgcdivagpggvsaaiadlsptqsdr
qlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflqih
chqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfdv

Timeline for d4eoca_:

• d4eoca_ is new in SCOPe 2.04-stable
  
• d4eoca_ appears in SCOPe 2.05
  
• d4eoca_ appears in the current release, SCOPe 2.08