Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) |
Domain d4ei5e1: 4ei5 E:7-185 [251764] Other proteins in same PDB: d4ei5b_, d4ei5c1, d4ei5c2, d4ei5d1, d4ei5d2, d4ei5e2, d4ei5e3, d4ei5f_, d4ei5g1, d4ei5h1, d4ei5h2 automated match to d4f7ca1 complexed with cis, flc, nag |
PDB Entry: 4ei5 (more details), 3.1 Å
SCOPe Domain Sequences for d4ei5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei5e1 d.19.1.1 (E:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d4ei5e1: