Lineage for d1ptoe_ (1pto E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110116Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 110286Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 110287Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 110297Domain d1ptoe_: 1pto E: [25137]
    Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_

Details for d1ptoe_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptoe_ b.40.2.1 (E:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOP Domain Coordinates for d1ptoe_:

Click to download the PDB-style file with coordinates for d1ptoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ptoe_: