Lineage for d4bqza1 (4bqz A:36-178)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606407Species Norway rat (Rattus norvegicus) [TaxId:10116] [256210] (6 PDB entries)
  8. 1606412Domain d4bqza1: 4bqz A:36-178 [251312]
    Other proteins in same PDB: d4bqza2
    automated match to d3cj7a1
    complexed with gnp, gol, mg

Details for d4bqza1

PDB Entry: 4bqz (more details), 2.05 Å

PDB Description: Rat NTPDase2 in complex with Mg GMPPNP
PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d4bqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bqza1 c.55.1.0 (A:36-178) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs
lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfr
garilsgqdegvfgwvtanylle

SCOPe Domain Coordinates for d4bqza1:

Click to download the PDB-style file with coordinates for d4bqza1.
(The format of our PDB-style files is described here.)

Timeline for d4bqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bqza2