Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries) identical sequence with verotoxin-1 B |
Domain d1dm0k_: 1dm0 K: [25115] Other proteins in same PDB: d1dm0a_, d1dm0l_ |
PDB Entry: 1dm0 (more details), 2.5 Å
SCOPe Domain Sequences for d1dm0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dm0k_ b.40.2.1 (K:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng ggfsevifr
Timeline for d1dm0k_: