Class b: All beta proteins [48724] (178 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries) |
Domain d4anva2: 4anv A:352-524 [251084] Other proteins in same PDB: d4anva1, d4anva3, d4anva4 automated match to d1e8wa2 complexed with 751, so4 |
PDB Entry: 4anv (more details), 2.13 Å
SCOPe Domain Sequences for d4anva2:
Sequence, based on SEQRES records: (download)
>d4anva2 b.7.1.0 (A:352-524) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslwdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwn vwlefsikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidh rfllrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc
>d4anva2 b.7.1.0 (A:352-524) automated matches {Human (Homo sapiens) [TaxId: 9606]} vslwdcdrkfrvkirgidipvlprnltvfveaniqhgqqvlcqrrtspkpfteevlwnvw lefsikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadklt satnpdkensmsisilldnyc
Timeline for d4anva2: