SCOPe 2.07: Domain d4anva2: 4anv A:352-524

Lineage for d4anva2 (4anv A:352-524)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)

8. Domain d4anva2: 4anv A:352-524 [251084]
   Other proteins in same PDB: d4anva1, d4anva3, d4anva4
   automated match to d1e8wa2
   complexed with 751, so4

Details for d4anva2

PDB Entry: 4anv, 2.13 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anva2:

Sequence, based on SEQRES records:

>d4anva2 b.7.1.0 (A:352-524) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslwdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwn
vwlefsikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidh
rfllrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc

Sequence, based on observed residues (ATOM records):

>d4anva2 b.7.1.0 (A:352-524) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslwdcdrkfrvkirgidipvlprnltvfveaniqhgqqvlcqrrtspkpfteevlwnvw
lefsikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadklt
satnpdkensmsisilldnyc

Timeline for d4anva2:

• d4anva2 first appeared in SCOPe 2.04
  
• d4anva2 appears in SCOPe 2.06
  
• d4anva2 appears in the current release, SCOPe 2.08