Lineage for d4akqa1 (4akq A:2-182)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382084Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 2382100Domain d4akqa1: 4akq A:2-182 [251058]
    automated match to d1gska1
    complexed with cu, edo, oxy; mutant

Details for d4akqa1

PDB Entry: 4akq (more details), 2.1 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: E498D mutant
PDB Compounds: (A:) spore coat protein

SCOPe Domain Sequences for d4akqa1:

Sequence, based on SEQRES records: (download)

>d4akqa1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d4akqa1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd
feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d4akqa1:

Click to download the PDB-style file with coordinates for d4akqa1.
(The format of our PDB-style files is described here.)

Timeline for d4akqa1: