Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) automatically mapped to Pfam PF01324 |
Family b.2.1.0: automated matches [254321] (1 protein) not a true family |
Protein automated matches [254735] (1 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256178] (2 PDB entries) |
Domain d4ae1b3: 4ae1 B:381-535 [251016] Other proteins in same PDB: d4ae1a1, d4ae1a2, d4ae1b1, d4ae1b2 automated match to d1f0la1 complexed with nca; mutant |
PDB Entry: 4ae1 (more details), 2.08 Å
SCOPe Domain Sequences for d4ae1b3:
Sequence, based on SEQRES records: (download)
>d4ae1b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
>d4ae1b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktkvnsklslffeiks
Timeline for d4ae1b3: