Lineage for d4ae0a2 (4ae0 A:201-380)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1695625Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1695641Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 1695656Family f.1.2.0: automated matches [254320] (1 protein)
    not a true family
  6. 1695657Protein automated matches [254734] (1 species)
    not a true protein
  7. 1695658Species Corynebacterium diphtheriae [TaxId:1717] [256177] (2 PDB entries)
  8. 1695659Domain d4ae0a2: 4ae0 A:201-380 [251009]
    Other proteins in same PDB: d4ae0a1, d4ae0a3
    automated match to d1ddta3
    mutant

Details for d4ae0a2

PDB Entry: 4ae0 (more details), 2 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d4ae0a2:

Sequence, based on SEQRES records: (download)

>d4ae0a2 f.1.2.0 (A:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay

Sequence, based on observed residues (ATOM records): (download)

>d4ae0a2 f.1.2.0 (A:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgigfaaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d4ae0a2:

Click to download the PDB-style file with coordinates for d4ae0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ae0a2: