Lineage for d4a68a3 (4a68 A:357-510)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382084Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 2382096Domain d4a68a3: 4a68 A:357-510 [250944]
    automated match to d1gska3
    complexed with cu, epe, mpd, oh, per; mutant

Details for d4a68a3

PDB Entry: 4a68 (more details), 2 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: D116N mutant
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4a68a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a68a3 b.6.1.0 (A:357-510) automated matches {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd

SCOPe Domain Coordinates for d4a68a3:

Click to download the PDB-style file with coordinates for d4a68a3.
(The format of our PDB-style files is described here.)

Timeline for d4a68a3: