Lineage for d4a2ha1 (4a2h A:22-151)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528843Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1528844Protein automated matches [190824] (20 species)
    not a true protein
  7. 1528937Species Coriolopsis gallica [TaxId:76126] [256171] (5 PDB entries)
  8. 1528947Domain d4a2ha1: 4a2h A:22-151 [250897]
    automated match to d1gyca1
    complexed with bma, cu, nag

Details for d4a2ha1

PDB Entry: 4a2h (more details), 2.3 Å

PDB Description: crystal structure of laccase from coriolopsis gallica ph 7.0
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d4a2ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2ha1 b.6.1.0 (A:22-151) automated matches {Coriolopsis gallica [TaxId: 76126]}
aigpvadltisngavspdgfsrqailvndvfpsplitgnkgdrfqlnvidnmtnhtmlks
tsihwhgffqhgtnwadgpafvnqcpistghaflydfqvpdqagtfwyhshlstqycdgl
rgpivvydpn

SCOPe Domain Coordinates for d4a2ha1:

Click to download the PDB-style file with coordinates for d4a2ha1.
(The format of our PDB-style files is described here.)

Timeline for d4a2ha1: