Lineage for d3zvjh_ (3zvj H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602527Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 1602562Domain d3zvjh_: 3zvj H: [250858]
    automated match to d2i81b_

Details for d3zvjh_

PDB Entry: 3zvj (more details), 3 Å

PDB Description: Crystal structure of high molecular weight (HMW) form of Peroxiredoxin I from Schistosoma mansoni
PDB Compounds: (H:) thioredoxin peroxidase

SCOPe Domain Sequences for d3zvjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvjh_ c.47.1.0 (H:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvcpteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvekhgevcpv

SCOPe Domain Coordinates for d3zvjh_:

Click to download the PDB-style file with coordinates for d3zvjh_.
(The format of our PDB-style files is described here.)

Timeline for d3zvjh_: