Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (23 PDB entries) |
Domain d3zuub_: 3zuu B: [250850] automated match to d3udba_ complexed with au, edo |
PDB Entry: 3zuu (more details), 2.7 Å
SCOPe Domain Sequences for d3zuub_:
Sequence, based on SEQRES records: (download)
>d3zuub_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpimhdsdryelvkdigsgnfgvarlmrdkqsnelvavkyiergekidenvkreiinhrs lrhpnivrfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgvsyc hamqvchrdlklentlldgspaprlkicafgyskssvlhsqpkdtvgtpayiapevllkk eydgkvadvwscgvtlyvmlvgaypfedpeepknfrktihrilnvqyaipdyvhispecr hlisrifvadpakrisipeirnhewflknlpadlmndntmttqfdesdqpgqsieeimqi iaeatvpp
>d3zuub_ d.144.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpimhdsdryelvkdigsgnfgvarlmrdkqsnelvavkyiergekidenvkreiinhrs lrhpnivrfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgvsyc hamqvchrdlklentlldgspaprlkicafgydtvgtpayiapevllkkeydgkvadvws cgvtlyvmlvgaypfedpeepknfrktihrilnvqyaipdyvhispecrhlisrifvadp akrisipeirnhewflknlpadlpgqsieeimqiiaeatvpp
Timeline for d3zuub_: