Lineage for d3vmfa1 (3vmf A:4-227)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479621Species Aeropyrum pernix [TaxId:272557] [231666] (4 PDB entries)
  8. 2479624Domain d3vmfa1: 3vmf A:4-227 [250616]
    Other proteins in same PDB: d3vmfa2, d3vmfa3
    automated match to d1skqa3
    complexed with gtp, mg, so4

Details for d3vmfa1

PDB Entry: 3vmf (more details), 2.3 Å

PDB Description: Archaeal protein
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3vmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vmfa1 c.37.1.0 (A:4-227) automated matches {Aeropyrum pernix [TaxId: 272557]}
kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak

SCOPe Domain Coordinates for d3vmfa1:

Click to download the PDB-style file with coordinates for d3vmfa1.
(The format of our PDB-style files is described here.)

Timeline for d3vmfa1: