Lineage for d3vdcc1 (3vdc C:9-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530315Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1530316Protein beta-Galactosidase [49804] (2 species)
  7. 1530324Species Escherichia coli [TaxId:562] [49805] (41 PDB entries)
    Uniprot P00722
  8. 1530427Domain d3vdcc1: 3vdc C:9-219 [250508]
    Other proteins in same PDB: d3vdca2, d3vdca3, d3vdca4, d3vdca5, d3vdcb2, d3vdcb3, d3vdcb4, d3vdcb5, d3vdcc2, d3vdcc3, d3vdcc4, d3vdcc5, d3vdcd2, d3vdcd3, d3vdcd4, d3vdcd5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3vdcc1

PDB Entry: 3vdc (more details), 2.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3vdcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdcc1 b.18.1.5 (C:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3vdcc1:

Click to download the PDB-style file with coordinates for d3vdcc1.
(The format of our PDB-style files is described here.)

Timeline for d3vdcc1: