Lineage for d3vd9c1 (3vd9 C:9-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530315Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1530316Protein beta-Galactosidase [49804] (2 species)
  7. 1530324Species Escherichia coli [TaxId:562] [49805] (41 PDB entries)
    Uniprot P00722
  8. 1530383Domain d3vd9c1: 3vd9 C:9-219 [250448]
    Other proteins in same PDB: d3vd9a2, d3vd9a3, d3vd9a4, d3vd9a5, d3vd9b2, d3vd9b3, d3vd9b4, d3vd9b5, d3vd9c2, d3vd9c3, d3vd9c4, d3vd9c5, d3vd9d2, d3vd9d3, d3vd9d4, d3vd9d5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3vd9c1

PDB Entry: 3vd9 (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3vd9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd9c1 b.18.1.5 (C:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3vd9c1:

Click to download the PDB-style file with coordinates for d3vd9c1.
(The format of our PDB-style files is described here.)

Timeline for d3vd9c1: