Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein automated matches [190204] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries) |
Domain d3v56d_: 3v56 D: [250316] automated match to d1kxga_ complexed with so4 |
PDB Entry: 3v56 (more details), 3 Å
SCOPe Domain Sequences for d3v56d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v56d_ b.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtqdclqliadsetptiqkgsytfvpwllsfkrgsaleekenkilvketgyffiygqvly tdktyamghliqrkkvhvfgdelslvtlfrciqnmpetlpnnscysagiakleegdelql aiprenaqisldgdvtffgalkll
Timeline for d3v56d_: