Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Saccharum officinarum [TaxId:4547] [256120] (2 PDB entries) |
Domain d3ul6a_: 3ul6 A: [250230] automated match to d3imad_ complexed with pe4 |
PDB Entry: 3ul6 (more details), 2.63 Å
SCOPe Domain Sequences for d3ul6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ul6a_ d.17.1.0 (A:) automated matches {Saccharum officinarum [TaxId: 4547]} dleaielarfavaehnsktnamleferlvkvrhqvvagtmhhftvqvkeagggkklyeak vwekvwenfkqlqsfqpvg
Timeline for d3ul6a_: