Lineage for d3uaof_ (3uao F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592439Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592440Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1592474Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1592475Protein automated matches [190499] (20 species)
    not a true protein
  7. 1592489Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)
  8. 1592491Domain d3uaof_: 3uao F: [250184]
    automated match to d3hb7a_
    complexed with act

Details for d3uaof_

PDB Entry: 3uao (more details), 2.4 Å

PDB Description: Structure and Catalytic Mechanism of the Vitamin B3 Degradative Enzyme Maleamate Amidohydrolase from Bordetalla bronchiseptica RB50
PDB Compounds: (F:) Putative isochorismatase

SCOPe Domain Sequences for d3uaof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uaof_ c.33.1.0 (F:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
syerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergwav
ahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafygt
mlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanlfd
mrqkyaavmthdealaktk

SCOPe Domain Coordinates for d3uaof_:

Click to download the PDB-style file with coordinates for d3uaof_.
(The format of our PDB-style files is described here.)

Timeline for d3uaof_: