Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189507] (93 PDB entries) |
Domain d3ua5a1: 3ua5 A:28-491 [250163] Other proteins in same PDB: d3ua5a2, d3ua5b2 automated match to d3ibda_ complexed with 06x, hem |
PDB Entry: 3ua5 (more details), 2.8 Å
SCOPe Domain Sequences for d3ua5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ua5a1 a.104.1.1 (A:28-491) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf lffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr
Timeline for d3ua5a1: